Portfolio ↗

Quiz

2868 questions of the kind that actually get asked — in interviews, in architecture review boards, and by the person who has to run the thing at 3 AM. Every answer states the trade-off rather than the slogan, and says when the obvious choice is the wrong one.

All areas2868 Architecture Fundamentals91 Distributed Systems101 Data Architecture90 Cloud Architecture87 Networking86 API & Integration Architecture87 Reliability & Resilience99 Observability92 Performance & Capacity Engineering90 Security Architecture95 Cost Architecture & FinOps92 Business Architecture93 Architecture Communication102 Enterprise Architecture100 Legacy Modernization92 AI-Era Architecture96 Software Architecture & Engineering93 Architecture Patterns94 Architecture Decision-Making101 The Architect's Meta-Skills102 Delivery & Release Engineering103 Platform Engineering & Developer Experience92 Testing & Quality Architecture102 Data Platform Architecture98 Streaming & Real-Time Data103 Data Governance & Semantics91 Frontend & Experience Architecture101 Edge, Mobile & IoT98 Regulatory & Data Protection Architecture99 Assurance, Audit & Model Risk98
Difficulty Any beginner intermediate advanced

2868 questions.

  1. Managed vs Self-Managed advanced

    Your team runs a large self-managed streaming cluster. Two engineers hold most of the operational knowledge. A managed alternative exists. How do you decide?

    2 min answer spotifymanaged-servicesriskdecision
  2. Master Data Management advanced

    A large enterprise has customer records in a dozen systems with no shared identifier. Design the master data approach.

    1 min answer mdmentity-resolutionidentitydata-quality
  3. Master Data Management advanced

    A retailer sells the same stock through stores, its website and marketplaces. Stock counts disagree. What is the architecture problem?

    2 min answer walmartretailinventoryconsistency
  4. Master Data Management intermediate

    An insurer has three customer masters: one in the policy system, one in claims, one in the broker portal. Each is authoritative for something. Leadership wants one. Give the sequence that gets there without a cutover weekend.

    2 min answer mdmgolden recordcoexistencemigration
  5. Master Data Management advanced

    Several systems each hold a version of the customer record and they disagree. What is the architectural approach?

    2 min answer ripplingmdmsystem-of-recordreconciliation
  6. Materialized Views intermediate

    A discussion platform precomputes ranked feeds as materialised views. What does this buy, and what are the failure modes?

    2 min answer materialized-viewsprecomputationstalenessrebuild
  7. Materialized Views advanced

    A read-heavy query is too expensive to compute on demand. Compare a database materialized view, an application-maintained read model and a stream-processed view, and describe how each handles staleness and rebuild.

    2 min answer materialized-viewscqrsread-modelstaleness
  8. Materialized Views advanced

    A ride-hailing platform maintains a materialised view of driver availability by geographic cell. What are the design decisions, and what breaks?

    2 min answer olamaterialized-viewfreshnessprojection
  9. Materialized Views beginner Multiple choice

    A tenant-scoped dashboard query over an 80 million row orders table takes 9 seconds. It filters one tenant id and the last 30 days and returns 40 rows. The only index is on created_at. A proposal is to add a nightly materialised view. Which change should come first?

    3 min answer materialized-viewsindexingprecomputationread-path
  10. Materialized Views advanced

    Your social feed precomputes each user's timeline when someone they follow posts. An account with 40 million followers joins. What breaks and how do you fix it?

    2 min answer feedfanouthybridscale
  11. Medallion Architecture intermediate

    A data platform organises tables into bronze, silver and gold layers. What determines what belongs in each, and what is the common failure?

    2 min answer databricksmedallionlayerscontracts
  12. Medallion Architecture beginner Multiple choice

    A platform lands raw order events in bronze, types and cleans them in silver, and builds a revenue table in gold. Finance finds that orders in three currencies have been converted at the wrong rate since July - the conversion is a CASE expression in the silver transformation. Which correction is the layering there to make possible?

    2 min answer medallionreprocessingbronzeidempotency