1. Architecture Decision-Making advanced

    Netflix built its own CDN; Dropbox moved storage off S3. Both are usually wrong. What conditions made them right, and how do you test for those conditions?

    2 min answer case-studybuild-vs-buynetflixdropbox
  2. Decision Practice advanced

    Three years of architectural decisions live in a wiki, in chat threads and in two shared documents. The team agrees to move decision records into the repository beside the code without a 300-page backfill. Give the sequence, and name the point of no return.

    3 min answer decision-recordsmigrationdocumentationgovernance
  3. Deciding Under Uncertainty advanced

    A decision must be made now and the information needed will not be available for six months. What should the approach be?

    2 min answer postmanuncertaintyoptionsreversibility
  4. Deciding Under Uncertainty advanced

    A sponsor wants a date for a programme with several unknowns. Refusing to estimate is not an option. How do you handle it?

    1 min answer meta-skillsestimationuncertaintycommunication
  5. Deciding Under Uncertainty advanced

    An architectural decision must be made with genuinely insufficient information and the cost of delay is real. How should it be approached?

    2 min answer uncertaintyoptionsexperimentsreversibility
  6. Deciding Under Uncertainty advanced

    An architecture decision must be made when the workload, scale and requirements are genuinely unknown. What approach works?

    2 min answer uncertaintyoptionsreversibilitytriggers
  7. Delivery vs Maintainability advanced

    How would you make the case for a two-sprint refactor to a product manager under delivery pressure?

    2 min answer technical-debtcommunicationevidencecapability
  8. Managed vs Self-Managed advanced

    Your team runs a large self-managed streaming cluster. Two engineers hold most of the operational knowledge. A managed alternative exists. How do you decide?

    2 min answer spotifymanaged-servicesriskdecision
  9. Monolith vs Microservices advanced

    A B2B analytics company runs 40 services with 12 engineers. Deploys are independent, but a typical feature touches four services and takes three weeks to reach production. Review this architecture: what would you merge, what would you leave alone, and how would you argue it?

    2 min answer microservicesconsolidationcouplingteam-topologies
  10. Monolith vs Microservices advanced

    A platform must choose between a modular monolith and microservices for a new product line. What evidence should decide it?

    1 min answer monolithmicroservicesteamsevidence
  11. Monolith vs Microservices advanced

    A team of fifteen wants to start a new product as microservices. How do you advise?

    1 min answer microservicesmonolitharchitecturesequencing
  12. Monolith vs Microservices advanced

    You have joined a 55-engineer product organisation with a six-year-old monolith. The VP of Engineering wants a microservices roadmap by Friday. Deploys queue for 40 minutes, the test suite takes 55 minutes, and two candidates recently turned down offers citing the monolith. Walk me through the conversation.

    3 min answer monolithmicroserviceslead-timestakeholders