Quiz
2627 questions of the kind that actually get asked — in interviews, in architecture review boards, and by the person who has to run the thing at 3 AM. Every answer states the trade-off rather than the slogan, and says when the obvious choice is the wrong one.
All areas2627
Architecture Fundamentals81
Distributed Systems101
Data Architecture90
Cloud Architecture77
Networking86
API & Integration Architecture78
Reliability & Resilience88
Observability81
Performance & Capacity Engineering90
Security Architecture85
Cost Architecture & FinOps82
Business Architecture93
Architecture Communication91
Enterprise Architecture91
Legacy Modernization82
AI-Era Architecture86
Software Architecture & Engineering84
Architecture Patterns84
Architecture Decision-Making91
The Architect's Meta-Skills92
Delivery & Release Engineering93
Platform Engineering & Developer Experience92
Testing & Quality Architecture90
Data Platform Architecture88
Streaming & Real-Time Data93
Data Governance & Semantics81
Frontend & Experience Architecture91
Edge, Mobile & IoT88
Regulatory & Data Protection Architecture90
Assurance, Audit & Model Risk88
45 questions in Architecture Decision-Making.
-
Architecture Decision-Making advanced
Netflix built its own CDN; Dropbox moved storage off S3. Both are usually wrong. What conditions made them right, and how do you test for those conditions?
2 min answer case-studybuild-vs-buynetflixdropbox -
Decision Practice advanced
Three years of architectural decisions live in a wiki, in chat threads and in two shared documents. The team agrees to move decision records into the repository beside the code without a 300-page backfill. Give the sequence, and name the point of no return.
3 min answer decision-recordsmigrationdocumentationgovernance -
Deciding Under Uncertainty advanced
A decision must be made now and the information needed will not be available for six months. What should the approach be?
2 min answer postmanuncertaintyoptionsreversibility -
Deciding Under Uncertainty advanced
A sponsor wants a date for a programme with several unknowns. Refusing to estimate is not an option. How do you handle it?
1 min answer meta-skillsestimationuncertaintycommunication -
Deciding Under Uncertainty advanced
An architectural decision must be made with genuinely insufficient information and the cost of delay is real. How should it be approached?
2 min answer uncertaintyoptionsexperimentsreversibility -
Deciding Under Uncertainty advanced
An architecture decision must be made when the workload, scale and requirements are genuinely unknown. What approach works?
2 min answer uncertaintyoptionsreversibilitytriggers -
Delivery vs Maintainability advanced
How would you make the case for a two-sprint refactor to a product manager under delivery pressure?
2 min answer technical-debtcommunicationevidencecapability -
Managed vs Self-Managed advanced
Your team runs a large self-managed streaming cluster. Two engineers hold most of the operational knowledge. A managed alternative exists. How do you decide?
2 min answer spotifymanaged-servicesriskdecision -
Monolith vs Microservices advanced
A B2B analytics company runs 40 services with 12 engineers. Deploys are independent, but a typical feature touches four services and takes three weeks to reach production. Review this architecture: what would you merge, what would you leave alone, and how would you argue it?
2 min answer microservicesconsolidationcouplingteam-topologies -
Monolith vs Microservices advanced
A platform must choose between a modular monolith and microservices for a new product line. What evidence should decide it?
1 min answer monolithmicroservicesteamsevidence -
Monolith vs Microservices advanced
A team of fifteen wants to start a new product as microservices. How do you advise?
1 min answer microservicesmonolitharchitecturesequencing -
Monolith vs Microservices advanced
You have joined a 55-engineer product organisation with a six-year-old monolith. The VP of Engineering wants a microservices roadmap by Friday. Deploys queue for 40 minutes, the test suite takes 55 minutes, and two candidates recently turned down offers citing the monolith. Walk me through the conversation.
3 min answer monolithmicroserviceslead-timestakeholders